Recombinant human Peroxiredoxin-1 protein

Relevance: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation
Product Info: GST tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Referrences: [1] "A human cDNA corresponding to a gene overexpressed during cell proliferation encodes a product sharing homology with amoebic and bacterial proteins." Prosperi M.T., Ferbus D., Karczinski I., Goubin G. J. Biol. Chem. 268:11050-11056(1993) [PubMed: 8496166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Cloning and sequence analysis of candidate human natural killer-enhancing factor genes." Shau H., Butterfield L.H., Chiu R., Kim A. Immunogenetics 40:129-134(1994) [PubMed: 8026862] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Alias: Natural killer cell-enhancing factor A,NKEF-A,Proliferation-associated gene protein,PAG,Thioredoxin peroxidase 2,Thioredoxin-dependent peroxide reductase 2.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	500 мкг
	Кат. номер:	CSB-RP011654h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Peroxiredoxin-1 protein. Примечание: дополнительная информация (на английском языке).