Recombinant human Protein AMBP
Relevance: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization. Ref.18 Trypstatin is a trypsin inhibitor
Product Info:
Source:
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV
Referrences: [1] "Sequence of a full length cDNA coding for human protein HC (alpha 1 microglobulin)." Traboni C., Cortese R. Nucleic Acids Res. 14:6340-6340(1986) [PubMed: 2428011] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "The mRNA for a proteinase inhibitor related to the HI-30 domain of inter-alpha-trypsin inhibitor also encodes alpha-1-microglobulin (protein HC)." Kaumeyer J.F., Polazzi J.O., Kotick M.P. Nucleic Acids Res. 14:7839-7850(1986) [PubMed: 2430261] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Liver. [3] "Structure of the human alpha 1-microglobulin-bikunin gene." Vetr H., Gebhard W. Biol. Chem. Hoppe-Seyler 371:1185-1196(1990) [PubMed: 1708673] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: Alpha-1 microglycoprotein Complex-forming glycoprotein heterogeneous in charge Bikunin EDC1 HI-30 Uronic-acid-rich protein.
Информация для заказа