Recombinant human Signal transducer CD24 protein
Relevance: Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells. Ref.7
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: SETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Referrences: [1] "CD24, a signal transducer modulating B cell activation responses, is a very short peptide with a glycosyl phosphatidylinositol membrane anchor." Kay R., Rosten P.M., Humphries R.K. J. Immunol. 147:1412-1416(1991) [PubMed: 1831224] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT SER-44. [2] "CD24, a signal-transducing molecule expressed on human B cells, is a major surface antigen on small cell lung carcinomas." Jackson D., Waibel R., Weber E., Bell J., Stahel R.A. Cancer Res. 52:5264-5270(1992) [PubMed: 1327504] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANTS SER-44 AND VAL-57. [3] "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], VARIANT SER-44. [4] "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA], VARIANT SER-44. Tissue: Ovary. [5] "Mapping of CD24 and homologous sequences to multiple chromosomal loci." Hough M.R., Rosten P.M., Sexton T.L., Kay R., Humphries R.K. Genomics 22:154-161(1994) [PubMed: 7959762] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-76.
Alias: Small cell lung carcinoma cluster 4 antigen,CD24.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP104644h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Signal transducer CD24 protein. Примечание: дополнительная информация (на английском языке). |