Recombinant human Tax1-binding protein 3 protein

Relevance: May play a role in the Rho signaling pathway. May act as an inhibitor of the Wnt signaling pathway. May play a role in activation of CDC42 by the viral protein HPV16 E6.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS
Referrences: [1] "The C-terminus of the HTLV-1 Tax oncoprotein mediates interaction with the PDZ domain of cellular proteins." Rousset R., Fabre S., Desbois C., Bantignies F., Jalinot P. Oncogene 16:643-654(1998) [PubMed: 9482110] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], INTERACTION WITH HTLV-1 TAX. Tissue: Peripheral blood lymphocyte. [2] "The genomic region encompassing the nephropathic cystinosis gene (CTNS): complete sequencing of a 200-kb segment and discovery of a novel gene within the common cystinosis-causing deletion." Touchman J.W., Anikster Y., Dietrich N.L., Maduro V.V.B., McDowell G., Shotelersuk V., Bouffard G.G., Beckstrom-Sternberg S.M., Gahl W.A., Green E.D. Genome Res. 10:165-173(2000) [PubMed: 10673275] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: Glutaminase-interacting protein 3,Tax interaction protein 1,TIP-1.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	500 мкг
	Кат. номер:	CSB-RP044454h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Tax1-binding protein 3 protein. Примечание: дополнительная информация (на английском языке).