Recombinant human Thioredoxin` protein
Relevance: Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity. Ref.16 Ref.18 Ref.19 Ref.21 Ref.24 ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55).
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: VKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Referrences: [1] "Cloning and expression of a cDNA for human thioredoxin." Wollman E.E., D'Auriol L., Rimsky L., Shaw A., Jacquot J.-P., Wingfield P., Graber P., Dessarps F. J. Biol. Chem. 263:15506-15512(1988) [PubMed: 3170595] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "ATL-derived factor (ADF), an IL-2 receptor/Tac inducer homologous to thioredoxin; possible involvement of dithiol-reduction in the IL-2 receptor induction." Tagaya Y., Maeda Y., Mitsui A., Kndo N., Matsui H., Hamuro J., Brown N., Arai K., Yokota T., Wakasugi H., Yodoi J. EMBO J. 8:757-764(1989) [PubMed: 2785919] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Isolation and characterization of human thioredoxin-encoding genes." Tonissen K.F., Wells J.R.E. Gene 102:221-228(1991) [PubMed: 1874447] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: Trx,ATL-derived factor,ADF,Surface-associated sulphydryl protein,SASP.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 50 мкг |
Кат. номер: | CSB-RP028144h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Thioredoxin` protein. Примечание: дополнительная информация (на английском языке). |