Recombinant human Transforming protein RhoA protein

Relevance: Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly.
Product Info: GST tagged
Source: E.coli derived
Purity: 95%
Image:

Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCL
Referrences: [1] "Nucleotide sequence of human rho cDNA clone 12." Yeramian P., Chardin P., Madaule P., Tavitian A. Nucleic Acids Res. 15:1869-1869(1987) [PubMed: 3822842] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Sequence of rho small GTP-binding protein cDNAs from human retina and identification of novel 5' end cloning artifacts." Fagan K.P., Oliveira L., Pittler S.J. Exp. Eye Res. 59:235-237(1994) [PubMed: 7835413] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Retina. [3] "cDNA clones of human proteins involved in signal transduction sequenced by the Guthrie cDNA resource center (www.cdna.org)." Puhl H.L. III, Ikeda S.R., Aronstam R.S. Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Brain.
Alias: Rho cDNA clone 12,h12.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	200 мкг
	Кат. номер:	CSB-RP008754h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Transforming protein RhoA protein. Примечание: дополнительная информация (на английском языке).