Recombinant human Transgelin protein
Relevance: Actin cross-linking/gelling protein By similarity. Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.
Product Info: GST tagged
Source: E.coli derived
Purity: 95%
Image:
Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: PBS buffer,20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS
Referrences: [1] "A novel gene encoding a smooth muscle protein is overexpressed in senescent human fibroblasts." Thweatt R., Lumpkin C.K. Jr., Goldstein S. Biochem. Biophys. Res. Commun. 187:1-7(1992) [PubMed: 1520290] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Fibroblast. [2] "Gene cloning and nucleotide sequence of SM22 alpha from the chicken gizzard smooth muscle." Nishida W., Kitami Y., Abe M., Kiwada K. Biochem. Int. 23:663-668(1991) [PubMed: 1872880] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Expression and cytogenetic localization of the human SM22 gene (TAGLN)." Camoretti-Mercado B., Forsythe S.M., Lebeau M.M., Espinosa R.D. III, Vieira J.E., Halayko A.J., Willadsen S., Kurtz B., Ober C., Evans G.A., Thweatt R., Shapiro S., Niu Q., Qin Y., Padrid P.A., Solway J. Genomics 49:452-457(1998) [PubMed: 9615232] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: SM22-alpha homolog.
Информация для заказа