Recombinant human Tumor necrosis factor protein
Relevance: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
Product Info: HIS-tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
Referrences: [1] "Tandem arrangement of genes coding for tumor necrosis factor (TNF-alpha) and lymphotoxin (TNF-beta) in the human genome." Nedospasov S.A., Shakhov A.N., Turetskaya R.L., Mett V.A., Azizov M.M., Georgiev G.P., Korobko V.G., Dobrynin V.N., Filippov S.A., Bystrov N.S., Boldyreva E.F., Chuvpilo S.A., Chumakov A.M., Shingarova L.N., Ovchinnikov Y.A. Cold Spring Harb. Symp. Quant. Biol. 51:611-624(1986) [PubMed: 3555974] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "Human tumour necrosis factor: precursor structure, expression and homology to lymphotoxin." Pennica D., Nedwin G.E., Hayflick J.S., Seeburg P.H., Derynck R., Palladino M.A., Kohr W.J., Aggarwal B.B., Goeddel D.V. Nature 312:724-729(1984) [PubMed: 6392892] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. [3] "Cloning and expression in Escherichia coli of the gene for human tumour necrosis factor." Shirai T., Yamaguchi H., Ito H., Todd C.W., Wallace R.B. Nature 313:803-806(1985) [PubMed: 3883195] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. [4] "Human lymphotoxin and tumor necrosis factor genes: structure, homology and chromosomal localization." Nedwin G.E., Naylor S.L., Sakaguchi A.Y., Smith D.H., Jarrett-Nedwin J., Pennica D., Goeddel D.V., Gray P.W. Nucleic Acids Res. 13:6361-6373(1985) [PubMed: 2995927] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA]. [5] "Molecular cloning of the complementary DNA for human tumor necrosis factor." Wang A.M., Creasey A.A., Ladner M.B., Lin L.S., Strickler J., van Arsdell J.N., Yamamoto R., Mark D.F. Science 228:149-154(1985) [PubMed: 3856324] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA].
Alias: Cachectin,TNF-alpha,Tumor necrosis factor ligand superfamily member 2,TNF-a.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 500 мкг |
Кат. номер: | CSB-RP074274h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Tumor necrosis factor protein. Примечание: дополнительная информация (на английском языке). |