Recombinant human Tumor necrosis factor receptor superfamily member 10D protein

Relevance: Receptor for the cytotoxic ligand TRAIL. Contains a truncated death domain and hence is not capable of inducing apoptosis but protects against TRAIL-mediated apoptosis. Reports are contradictory with regards to its ability to induce the NF-kappa-B pathway. According to Ref.1, it cannot but according to Ref.2, it can induce the NF-kappa-B pathway.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: IPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLAS
Referrences: [1] "A novel receptor for Apo2L/TRAIL contains a truncated death domain." Marsters S.A., Sheridan J.P., Pitti R.M., Huang A., Skubatch M., Baldwin D., Yuan J., Gurney A., Goddard A.D., Godowski P., Ashkenazi A. Curr. Biol. 7:1003-1006(1997) [PubMed: 9382840] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF N-TERMINUS. Tissue: Fetal lung. [2] "The novel receptor TRAIL-R4 induces NF-kappaB and protects against TRAIL-mediated apoptosis, yet retains an incomplete death domain." Degli-Esposti M.A., Dougall W.C., Smolak P.J., Waugh J.Y., Smith C.A., Goodwin R.G. Immunity 7:813-820(1997) [PubMed: 9430226] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION, VARIANTS SER-35 AND LEU-310. Tissue: Foreskin fibroblast and Peripheral blood lymphocyte. [3] "TRUNDD, a new member of the TRAIL receptor family that antagonizes TRAIL signalling." Pan G., Ni J., Yu G.-L., Wei Y.-F., Dixit V.M. FEBS Lett. 424:41-45(1998) [PubMed: 9537512] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], CHARACTERIZATION.
Alias: Decoy receptor 2,DcR2,TNF-related apoptosis-inducing ligand receptor 4,TRAIL receptor 4,TRAIL-R4,TRAIL receptor with a truncated death domain,CD264.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	500 мкг
	Кат. номер:	CSB-RP082074h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human Tumor necrosis factor receptor superfamily member 10D protein. Примечание: дополнительная информация (на английском языке).