ООО «Лабораторная Диагностика»
ООО «Лабораторная Диагностика» info@LD.ru    тел.: +7 495 369-20-43
 Главная   Новости   О компании  Каталог продукции и цены   Оформить заказ   Контакты 
 
  
Каталог продукции
  Рекомбинантные белки
  Cusabio
  OriGene
  Panomics
  ProSpec
  · Гормоны
  Евроген
  Гематология и трансфузиология
  Гемостаз  
  Иммуногистохимия
  Иммуноферментный анализ (ИФА)
  Иммунохимия  
  Клеточные технологии
  Клиническая биохимия
  Коагулометрия  
  Микробиология  
  Молекулярная диагностика
  Мультиплексный анализ  
  Оборудование для биохимии и
  молекулярной биологии
  Общелабораторное оборудование
  Онкология  
  Пищевая промышленность  
  Программное обеспечение  
  Проточная цитометрия
  ПЦР-лаборатория
  Репродуктивные технологии
  Секвенирование NGS
  Сортировка клеток
  Спектрофотометрия  
  Трансплантология
  Цитогенетическая диагностика
  Экспресс-лаборатория  

 
/ Каталог / Протеомика / Белки / Рекомбинантные белки / Рекомбинантные белки Cusabio

Recombinant human Tumor necrosis factor receptor superfamily member 11A Protein

Relevance: RANKL and RANK are members of the TNF superfamily of ligands and receptors that play an important role in the regulation of specific immunity and bone turnover. RANK (receptor) was originally identified as a dendritic-cell-membrane protein, which by interacting with RANKL augments the ability of dendritic cells to stimulate na�ve T cell proliferation and to promote the survival of RANK + T cells. RANK is also expressed in a variety of tissues including skeletal muscle, thymus, liver, colon, small intestine and adrenal gland. The RANK/RANKL interaction is important in the regulation of osteoclastogenesis and in dendritic-cell-mediated T cell immune responses. Impairments in RANK signaling have been implicated in the induction of expansile osteolysis and Paget disease of bone (PDB2). Recombinant human sRANK receptor is a 19.3 kDa polypeptide containing the TNFR homologous cysteine rich portion of the extracellular domain of RANK receptor (175 amino acid residues).
Product Info: His-tagged
Source: E.coli derived
Purity: >90% by SDS-PAGE
Image:
Tested applications: ELISA, ligand binding assy
Storage Buffer: PBS (PH: 8.0), 50% glycerin
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: IAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARKPPNEPHVYLP
Referrences: [1] "A homologue of the TNF receptor and its ligand enhance T-cell growth and dendritic-cell function." Anderson D.M., Maraskovsky E., Billingsley W.L., Dougall W.C., Tometsko M.E., Roux E.R., Teepe M.C., DuBose R.F., Cosman D., Galibert L. Nature 390:175-179(1997) [PubMed: 9367155] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Dendritic cell. [2] "RANK is the essential signaling receptor for osteoclast differentiation factor in osteoclastogenesis." Nakagawa N., Kinosaki M., Yamaguchi K., Shima N., Yasuda H., Yano K., Morinaga T., Higashio K. Biochem. Biophys. Res. Commun. 253:395-400(1998) [PubMed: 9878548] [Abstract] Cited for: FUNCTION.
Alias: Osteoclast differentiation factor receptor,ODFR,Receptor activator of NF-KB,CD265.

Информация для заказа

Область использования:Производство:Cusabio
Метод: 
Объем:50 мкг 
Кат. номер:CSB-RP084674h
Цена (с НДС 20%):по запросуВ корзину
Recombinant human Tumor necrosis factor receptor superfamily member 11A ProteinНаименование: Recombinant human Tumor necrosis factor receptor superfamily member 11A Protein.
Примечание: дополнительная информация (на английском языке).
   
© ООО «Лабораторная Диагностика»
info@LD.ru   тел.: +7 495 369-20-43