Recombinant human Tumor necrosis factor receptor superfamily member 1A protein
Relevance: Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: VPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGT
Referrences: [1] "Molecular cloning and expression of the human 55 kd tumor necrosis factor receptor." Loetscher H., Pan Y.-C.E., Lahm H.-W., Gentz R., Brockhaus M., Tabuchi H., Lesslauer W. Cell 61:351-359(1990) [PubMed: 2158862] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). [2] "Molecular cloning and expression of a receptor for human tumor necrosis factor." Schall T.J., Lewis M., Koller K.J., Lee A., Rice G.C., Wong G.H.W., Getanaga T., Granger G.A., Lentz R., Raab H., Kohr W.J., Goeddel D.V. Cell 61:361-370(1990) [PubMed: 2158863] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta. [3] "Molecular cloning and expression of human and rat tumor necrosis factor receptor chain (p60) and its soluble derivative, tumor necrosis factor-binding protein." Himmler A., Maurer-Fogy I., Kroenke M., Scheurich P., Pfizenmaier K., Lantz M., Olsson I., Hauptmann R., Stratowa C., Adolf G.R. DNA Cell Biol. 9:705-715(1990) [PubMed: 1702293] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). [4] "Soluble forms of tumor necrosis factor receptors (TNF-Rs). The cDNA for the type I TNF-R, cloned using amino acid sequence data of its soluble form, encodes both the cell surface and a soluble form of the receptor." Nophar Y., Kemper O., Brakebusch C., Engelmann H., Zwang R., Aderka D., Holtmann H., Wallach D. EMBO J. 9:3269-3278(1990) [PubMed: 1698610] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 41-53; 110-124 AND 199-201 (ISOFORM 1). [5] "Cloning of human tumor necrosis factor (TNF) receptor cDNA and expression of recombinant soluble TNF-binding protein." Gray P.W., Barrett K., Chantry D., Turner M., Feldman M. Proc. Natl. Acad. Sci. U.S.A. 87:7380-7384(1990) [PubMed: 2170974] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Placenta.
Alias: Tumor necrosis factor receptor 1,TNF-R1,Tumor necrosis factor receptor type I,TNF-RI,TNFR-I,p55,p60,CD120a.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP072244h |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant human Tumor necrosis factor receptor superfamily member 1A protein. Примечание: дополнительная информация (на английском языке). |