Recombinant human Ubiquitin-like protein ISG15 protein
Relevance: Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections. Ref.12 Ref.13 Ref.14 Ref.15 Ref.20 Ref.21 In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy By similarity. Ref.12 Ref.13 Ref.14 Ref.15 Ref.20 Ref.21
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
Referrences: [1] "Molecular characterization of the interferon-induced 15-kDa protein. Molecular cloning and nucleotide and amino acid sequence." Blomstrom D.C., Fahey D., Kutny R., Korant B.D., Knight E. Jr. J. Biol. Chem. 261:8811-8816(1986) [PubMed: 3087979] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Interferon-induced transcription of a gene encoding a 15-kDa protein depends on an upstream enhancer element." Reich N., Evans B., Levy D., Fahey D., Knight E. Jr., Darnell J.E. Jr. Proc. Natl. Acad. Sci. U.S.A. 84:6394-6398(1987) [PubMed: 3476954] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "A 15-kDa interferon-induced protein is derived by COOH-terminal processing of a 17-kDa precursor." Knight E. Jr., Fahey D., Cordova B., Hillman M. Jr., Kutny R., Reich N., Blomstrom D.C. J. Biol. Chem. 263:4520-4522(1988) [PubMed: 3350799] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEOLYTIC PROCESSING. [4] Erratum Knight E. Jr., Fahey D., Cordova B., Hillman M. Jr., Kutny R., Reich N., Blomstrom D.C. J. Biol. Chem. 263:10040-10040(1988) [5] "Conjugation by ubiquitin-like proteins." Kamitani T., Fukuda-Kamitani T. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA], VARIANT ASN-83. Tissue: Testis.
Alias: Interferon-induced 15 kDa protein,Interferon-induced 17 kDa protein,IP17,Ubiquitin cross-reactive protein,hUCRP.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP097444h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Ubiquitin-like protein ISG15 protein. Примечание: дополнительная информация (на английском языке). |