Recombinant human Vascular endothelial growth factor C protein
Relevance: Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
Product Info: GST tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Referrences: [1] "A novel vascular endothelial growth factor, VEGF-C, is a ligand for the Flt4 (VEGFR-3) and KDR (VEGFR-2) receptor tyrosine kinases." Joukov V., Pajusola K., Kaipainen A., Chilov D., Lahtinen I., Kukk E., Saksela O., Kalkkinen N., Alitalo K. EMBO J. 15:290-298(1996) [PubMed: 8617204] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 103-120. [2] Erratum Joukov V., Pajusola K., Kaipainen A., Chilov D., Lahtinen I., Kukk E., Saksela O., Kalkkinen N., Alitalo K. EMBO J. 15:1751-1751(1996) [PubMed: 8612600] [Abstract] [3] "Vascular endothelial growth factor-related protein: a ligand and specific activator of the tyrosine kinase receptor Flt4." Lee J., Gray A., Yuan J., Luoh S.-M., Avraham H., Wood W.I. Proc. Natl. Acad. Sci. U.S.A. 93:1988-1992(1996) [PubMed: 8700872] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Glial tumor.
Alias: VEGF-C,Flt4 ligand,Flt4-L,Vascular endothelial growth factor-related protein,VRP.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP075454h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant human Vascular endothelial growth factor C protein. Примечание: дополнительная информация (на английском языке). |