Recombinant human V-type proton ATPase subunit E 1 protein

Relevance: Subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Product Info: GST-tagged
Source: E.coli derived
Purity: 95%
Image:

Tested applications: SDS-PAGE, ELISA, Western blot
Storage Buffer: 6M guanidine hydrochloride,20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: ALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKF
Referrences: [1] "Immunologic evidence that vacuolar H+ ATPases with heterogeneous forms of Mr = 31,000 subunit have different membrane distributions in mammalian kidney." Hemken P., Guo X.-L., Wang Z.-Q., Zhang K., Gluck S. J. Biol. Chem. 267:9948-9957(1992) [PubMed: 1533641] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "The E subunit of vacuolar H(+)-ATPase localizes close to the centromere on human chromosome 22." Baud V., Mears A., Lamour V., Scamps C., McDermid A., Lipinski M. Hum. Mol. Genet. 3:335-339(1994) [PubMed: 8004105] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] "Cloning and tissue distribution of subunits C, D, and E of the human vacuolar H(+)-ATPase." van Hille B., Vanek M., Richener H., Green J.R., Bilbe G. Biochem. Biophys. Res. Commun. 197:15-21(1993) [PubMed: 8250920] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Osteoclastoma.
Alias: V-ATPase subunit E 1,V-ATPase 31 kDa subunit,p31,Vacuolar proton pump subunit E 1.

Информация для заказа

Область использования: Рекомбинантные белки Cusabio	Производство:	Cusabio
	Метод:
	Объем:	200 мкг
	Кат. номер:	CSB-RP022954h
Цена (с НДС 20%):	по запросу	В корзину
Наименование: Recombinant human V-type proton ATPase subunit E 1 protein. Примечание: дополнительная информация (на английском языке).