Recombinant hunman Interleukin-15 protein
Relevance: Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Referrences: [1] "Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor." Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alderson M.R., Watson J.D., Anderson D.M., Giri J.G. Science 264:965-968(1994) [PubMed: 8178155] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S48AA). Tissue: Bone marrow. [2] "Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15)." Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T. Cytokine 8:667-674(1996) [PubMed: 8932977] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] "Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines." Meazza R., Verdiani S., Biassoni R., Coppolecchia M., Gaggero A., Orengo A.M., Colombo M.P., Azzarone B., Ferrini S. Oncogene 12:2187-2192(1996) [PubMed: 8668345] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA). Tissue: Lung cancer.
Alias: IL-15.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP066394h |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant hunman Interleukin-15 protein. Примечание: дополнительная информация (на английском языке). |