Recombinant mouse C-C motif chemokine 7 protein
Relevance: Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity By similarity.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Referrences: [1] "Immunoglobulin E plus antigen challenge induces a novel intercrine/chemokine in mouse mast cells." Kulmburg P.A., Huber N.E., Scheer B.J., Wrann M., Baumruker T. J. Exp. Med. 176:1773-1778(1992) [PubMed: 1281219] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Mast cell. [2] "Mouse macrophage derived monocyte chemotactic protein-3: cDNA cloning and identification as MARC/FIC." Thirion S., Nys G., Fiten P., Masure S., van Damme J., Opdenakker G. Biochem. Biophys. Res. Commun. 201:493-499(1994) [PubMed: 8002978] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [3] Werner F. Submitted (JUN-1992) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE. [4] "The product of a novel growth factor-activated gene, fic, is a biologically active 'C-C'-type cytokine." Heinrich J.N., Ryseck R.P., Macdonald-Bravo H., Bravo R. Mol. Cell. Biol. 13:2020-2030(1993) [PubMed: 8455595] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [5] "A transcription factor with AP3-like binding specificity mediates gene regulation after an allergic triggering with IgE and Ag in mouse mast cells." Jarmin D.I., Kulmburg P.A., Huber N.E., Baumann G., Prieschl-Strassmayr E.E., Baumruker T. J. Immunol. 153:5720-5729(1994) [PubMed: 7989769] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Alias: Intercrine/chemokine MARC,Monocyte chemoattractant protein 3,Monocyte chemotactic protein 3,MCP-3,Protein FIC,Small-inducible cytokine A7.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 50 мкг |
Кат. номер: | CSB-RP090974m |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant mouse C-C motif chemokine 7 protein. Примечание: дополнительная информация (на английском языке). |