Recombinant mouse C-X-C motif chemokine 11 protein
Relevance: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
![](http://www.cusabio.cn/admin//upload_files/other/_20120323150358_NDc=.jpg)
Tested applications: SDS-PAGE, ELISA
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MNRKVTAIAAAIIWATAAGMKGRCCIGGMKAVKMAIKASVIYSNGCDKVVIVTMKAHKRRCDRSKARIMAIKKNRRNM
Referrences: [1] "Cloning, genomic sequence, and chromosome mapping of scyb11, the murine homologue of SCYB11 (alias betaR1/H174/SCYB9B/I-TAC/IP-9/CXCL11)." Meyer M., Erdel M., Duba H.C., Werner E.R., Werner-Felmayer G. Cytogenet. Cell Genet. 88:278-282(2000) [PubMed: 10828609] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "The murine chemokine CXCL11 (IFN-inducible T cell alpha chemoattractant) is an IFN-gamma- and lipopolysaccharide-inducible glucocorticoid-attenuated response gene expressed in lung and other tissues during endotoxemia." Widney D.P., Xia Y.-R., Lusis A.J., Smith J.B. J. Immunol. 164:6322-6331(2000) [PubMed: 10843686] [Abstract] Cited for: NUCLEOTIDE SEQUENCE.
Alias: Interferon-inducible T-cell alpha chemoattractant,I-TAC,Small-inducible cytokine B11.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 500 мкг |
Кат. номер: | CSB-RP092874m |
Цена (с НДС 20%): | по запросу | В корзину ![](/catalog/cart.gif) |
Наименование: Recombinant mouse C-X-C motif chemokine 11 protein. Примечание: дополнительная информация (на английском языке). |