Recombinant mouse C-X-C motif chemokine 2 protein
Relevance: Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0,200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Referrences: [1] "Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues." Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A. J. Exp. Med. 172:911-919(1990) [PubMed: 2201751] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Identification and characterization of macrophage inflammatory protein 2." Wolpe S.D., Sherry B., Juers D., Davatelis G., Yurt R.W., Cerami A. Proc. Natl. Acad. Sci. U.S.A. 86:612-616(1989) [PubMed: 2643119] [Abstract] Cited for: PROTEIN SEQUENCE OF 28-59. [3] "Solution structure of murine macrophage inflammatory protein-2." Shao W., Jerva L.F., West J., Lolis E., Schweitzer B.I. Biochemistry 37:8303-8313(1998) [PubMed: 9622482] [Abstract] Cited for: STRUCTURE BY NMR OF 28-100.
Alias: Macrophage inflammatory protein 2,MIP2.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP092274m |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant mouse C-X-C motif chemokine 2 protein. Примечание: дополнительная информация (на английском языке). |