Recombinant Mouse Growth-regulated alpha protein
Relevance: Has chemotactic activity for neutrophils. Contributes to neutrophil activation during inflammation By similarity. Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. KC(5-72) shows a highly enhanced hematopoietic activity.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Referrences: [1] "The platelet-derived growth factor-inducible KC gene encodes a secretory protein related to platelet alpha-granule proteins." Oquendo P., Alberta J., Wen D., Graycar J.L., Derynck R., Stiles C.D. J. Biol. Chem. 264:4133-4137(1989) [PubMed: 2917992] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] "Cloning and sequence of a secretory protein induced by growth factors in mouse fibroblasts." Ryseck R.P., Macdonald-Bravo H., Mattei M.-G., Bravo R. Exp. Cell Res. 180:266-275(1989) [PubMed: 2909392] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [3] Bozic C.R., Kolakowski L.F. Jr., von Uexkull C., Garcia-Rodriguez M., Conklyn M.J., Breslow R., Showell H.J., Gerard N.P., Gerard C. Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: 129/Sv.
Alias: C-X-C motif chemokine 1,Platelet-derived growth factor-inducible protein KC,Secretory protein N51.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP092194m |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant Mouse Growth-regulated alpha protein. Примечание: дополнительная информация (на английском языке). |