Recombinant Mouse Heparin-binding growth factor 2 protein
Relevance: Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:
Tested applications: SDS-PAGE, ELISA
Storage Buffer: 6M guanidine hydrochloride, 20mM Tris
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Referrences: [1] "Isolation of cDNAs encoding four mouse FGF family members and characterization of their expression patterns during embryogenesis." Hebert J.M., Basilico C., Goldfarb M., Haub O., Martin G.R. Dev. Biol. 138:454-463(1990) [PubMed: 2318343] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. [2] Ma R.Z., Teuscher C. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Strain: A/J, C57BL/6J and NOD/LtJ. Tissue: Spleen. [3] "Expression of a binding protein for FGF is associated with epithelial development and skin carcinogenesis." Kurtz A., Wang H.-L., Darwiche N., Harris V., Wellstein A. Oncogene 14:2671-2681(1997) [PubMed: 9178765] [Abstract] Cited for: INTERACTION WITH FGF2.
Alias: Basic fibroblast growth factor,bFGF.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 1 мг |
Кат. номер: | CSB-RP062574m |
Цена (с НДС 20%): | по запросу | В корзину |
Наименование: Recombinant Mouse Heparin-binding growth factor 2 protein. Примечание: дополнительная информация (на английском языке). |