Recombinant New Delhi Beta-lactamase NDM-1 protein
Relevance: Enterobacteriaceae carrying this gene (identified by PCR) have been isolated in Sweden, India, Pakistan, Bangladesh, England, Scotland, Northern Ireland, Australia and the USA. The organisms they were identified in were K.pneumoniae, Enterobacter cloacae, E.coli, Proteus spp, Citrobacter freundii, Morganella morganii, Providencia spp and Klebsille oxytoca. In India most isolates were from community-acquired infections rather than hospital-acquired infections, indicating the gene is widespread in the environment.Confers resistance to many beta-lactam antibiotics, including some carbapenems. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Image:

Tested applications: ELISA, Western blot
Storage Buffer: PBS buffer
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG
Referrences: [1]"Characterization of a new metallo-beta-lactamase gene, bla(NDM-1), and a novel erythromycin esterase gene carried on a unique genetic structure in Klebsiella pneumoniae sequence type 14 from India." Yong D., Toleman M.A., Giske C.G., Cho H.S., Sundman K., Lee K., Walsh T.R. Antimicrob. Agents Chemother. 53:5046-5054(2009) [2]"Detection of Enterobacteriaceae isolates carrying metallo-beta-lactamase -United States, 2010." Limbago B., Kallen A. MMWR Morb. Mortal. Wkly. Rep. 59:750-750(2010)
Alias: NDM-1,Metallo-beta-lactamase NDM-1.
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 200 мкг |
Кат. номер: | CSB-RP076174Ba |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant New Delhi Beta-lactamase NDM-1 protein. Примечание: дополнительная информация (на английском языке). |