Recombinant Rat Insulin-like growth factor I protein
Relevance: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in rat bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake.
Product Info: GST tagged
Source: E. coli derived
Purity: 90%
Image:

Tested applications: ELISA, Western blot
Storage Buffer: PBS buffer, 20mM GSH
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA sequence: GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKSA
Referrences: [1] "Identification, characterization, and regulation of a rat complementary deoxyribonucleic acid which encodes insulin-like growth factor-I." Murphy L.J., Bell G.I., Duckworth M.L., Friesen H.G. Endocrinology 121:684-691(1987) [2] "Primary structure of rat insulin-like growth factor-I and its biological activities." Tamura K., Kobayashi M., Ishii Y., Tamura T., Hashimoto K., Nakamura S., Niwa M., Zapf J. J. Biol. Chem. 264:5616-5621(1989)
Alias: .
Информация для заказа
Область использования: | Производство: | Cusabio |
Метод: | |
Объем: | 10 мкг |
Кат. номер: | CSB-RP076044r |
Цена (с НДС 20%): | по запросу | В корзину  |
Наименование: Recombinant Rat Insulin-like growth factor I protein. Примечание: дополнительная информация (на английском языке). |