Наименование: Recombinant Human Interleukin-22(IL22).
Примечание: Expression Region: 34-179aa; Full Length of Mature Protein
Tag information: Tag-Free
Target Protein Sequence:
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Biological activity: Fully biologically active when compared to standard. The ED50 as determined by inducing IL-10 secretion of human COLO 205 cells is less than 0.3 ng/ml, corresponding to a specific activity of >3.3x106 IU/mg.
|
