Наименование: Recombinant Human Growth-regulated alpha protein(CXCL1) .
Примечание: Expression Region: 35-107aa; Full Length of Mature Protein
Tag information: Tag-Free
Target Protein Sequence:
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Biological activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 10-50 ng/ml.
|
