Наименование: Recombinant Human Interleukin-15 protein(IL15).
Примечание: Expression Region: 49-162aa; Full Length of Mature Protein
Tag information: Tag-Free
Target Protein Sequence:
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Biological activity: Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine CTLL-2 cells is less than 0.5 ng/ml, corresponding to a specific activity of >2.0x106 IU/mg.
|
