Наименование: Recombinant Human Stromal cell-derived factor 1 protein(CXCL12).
Примечание: Expression Region: 22-93aa; Full Length of Mature Protein
Tag information: Tag-Free
Target Protein Sequence:
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
Biological activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml.
|
