Наименование: Recombinant Treponema pallidum 17 kDa lipoprotein(tpp17) >> Yeast.
Примечание: Recombinant Treponema pallidum 17 kDa lipoprotein(tpp17)
Expression Region: 22-156aa; Full Length of Mature Protein
Tag information: tag type will be determined during the manufacturing process.
Target Protein Sequence (The complete sequence will be provided upon request, including tag sequence, target protein sequence and linker sequence):
CVSCTTVCPHAGKAKAEKVECALKGGIFRGTLPAADCPGIDTTVTFNADGTAQKVELALEKKSAPSPLTYRGTWMVREDGIVELSLVSSEQSKAPHEKELYELIDSNSVRYMGAPGAGKPSKEMAPFYVLKKTKK
|
