ООО «Лабораторная Диагностика»
ООО «Лабораторная Диагностика» info@LD.ru    тел.: +7 495 369-20-43
 Главная   Новости   О компании  Каталог продукции и цены   Оформить заказ   Контакты 
 
  
Каталог продукции
  Гематология и трансфузиология
  Гемостаз  
  Иммуногистохимия
  Иммуноферментный анализ (ИФА)
  Иммунохимия  
  Клеточные технологии
  Клиническая биохимия
  Коагулометрия  
  Микробиология  
  Молекулярная диагностика
  Мультиплексный анализ  
  Оборудование для биохимии и
  молекулярной биологии
  Общелабораторное оборудование
  Онкология  
  Пищевая промышленность  
  Программное обеспечение  
  Проточная цитометрия
  ПЦР-лаборатория
  Рекомбинантные белки
  Репродуктивные технологии
  Секвенирование NGS
  Сортировка клеток
  Спектрофотометрия  
  Трансплантология
  Цитогенетическая диагностика
  Экспресс-лаборатория  

 
/ Каталог / Протеомика / Белки / Белки производства Cusabio

Recombinant Human Mucin-17(MUC17),partial (Active)

Description
This Human MUC17 (Mucin-17) recombinant protein was produced in mammalian cell,
where the gene sequence encoding human MUC17 (4131-4390aa) was expressed with the C-terminal 10xHis tag.
The purity of this MUC17 protein was greater than 95% by SDS-PAGE. The activity was tested.
As a newly discovered mucin, MUC17 (Mucin-17) belongs to the membrane-bound mucin family.
Mucins are highly O-glycosylated linear glycoproteins secreted by higher organisms to protect and
lubricate epithelial cell surfaces and are involved in the regulation of immune responses, inflammation,
adhesion, and tumorigenesis. M...Read more
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/ug as determined by LAL method.
Activity Measured by its binding ability in a functional ELISA.
Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody (CSB-RA727848MA1HU),
the EC50 is 0.9057-1.259 ng/mL.
Target Names MUC17
Uniprot No. Q685J3
Research Area other
Alternative Names (MUC-17)(Small intestinal mucin-3)(MUC-3)
Molecular Characterization
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 4131-4390aa
Target Protein Sequence RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQT
FTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQN
ITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL
Mol. Weight 32.0kDa
Protein Length Partial
Tag Info C-terminal 10xHis-tagged
Form Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for
the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please
reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of
glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of
glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Информация для заказа

Область использования:Производство:Cusabio
Метод: 
Объем: 
Кат. номер:CSB-MP727848HU
Цена (с НДС 20%):по запросуВ корзину
Наименование: Recombinant Human Mucin-17(MUC17),partial (Active).
Примечание:
   
© ООО «Лабораторная Диагностика»
info@LD.ru   тел.: +7 495 369-20-43